Analytical Data
-
Gene name
TSPAN6
- Application
-
Alternative Names
TSPAN6; TM4SF6; UNQ767/PRO1560; Tetraspanin-6; Tspan-6; A15 homolog; Putative NF-kappa-B-activating Protein 321; T245 Protein; Tetraspanin TM4-D; Transmembrane 4 superfamily member 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43657
-
Expression Region
1-245 aa
-
AA Sequence
MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV
-
Molecular Weight
52.58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TSPAN6 (tetraspanin 6) is a member of the tetraspanin superfamily, characterized by four transmembrane domains and a multifunctional role in cellular processes. It is primarily expressed in immune cells and plays a crucial role in modulating cell signaling, adhesion, and migration. Research into TSPAN6 has gained significant attention due to its involvement in various physiological and pathological processes, including immune response regulation, cancer progression, and infectious diseases. Studies have indicated that TSPAN6 interacts with various membrane proteins, influencing their distribution and function, which suggests its potential as a therapeutic target. The recombinant expression of TSPAN6 enables detailed functional studies and the exploration of its interactions at the molecular level. Additionally, the generation of TSPAN6 recombinant proteins can aid in the development of diagnostic tools and vaccines, as its expression patterns might serve as biomarkers for certain diseases. Understanding the biological significance of TSPAN6 and its pathways holds promise for advancing therapeutic strategies in immunology and oncology. As research progresses, elucidating the precise roles of TSPAN6 in cellular contexts remains a critical objective, further highlighting its potential in translational research and clinical applications.
