Cat: PAX2000-12914

Recombinant Human ZNF544 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZNF544

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Zinc finger Protein 544; Zinc finger Protein AF020591; ZN544_HUMAN; ZNF 544; ZNF544

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6NX49

  • Expression Region

    1-106 aa

  • AA Sequence

    MEARSMLVPPQASVCFEDVAMAFTQEEWEQLDLAQRTLYREVTLETWEHIVSLGLFLSKSDVISQLEQEEDLCRAEQEAPRGTSGLSQVTGVVADGSFRFPVWDFT

  • Molecular Weight

    38.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZNF544, a member of the zinc finger protein family, has emerged as a subject of interest in molecular biology due to its potential roles in gene regulation, development, and disease. This protein is characterized by its zinc finger motifs, which enable it to bind DNA and interact with other proteins, suggesting a function in transcriptional regulation. Recent studies have highlighted its implications in various biological processes, including stem cell differentiation and cancer progression. Notably, mutations or aberrant expression of ZNF544 have been associated with certain malignancies, underscoring its relevance in oncogenic pathways. The recombination and expression of ZNF544 as a recombinant protein in laboratory settings provide valuable insights into its functional mechanics and interactions with other cellular components. By elucidating the structural and functional properties of ZNF544, researchers aim to better understand its biological significance and therapeutic potential, establishing a foundation for future studies aimed at targeting its pathways in disease contexts. This growing body of research not only enhances our understanding of ZNF544 itself but also contributes to the broader field of epigenetics and gene regulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US