Analytical Data
-
Gene name
ZNF544
- Application
-
Alternative Names
Zinc finger Protein 544; Zinc finger Protein AF020591; ZN544_HUMAN; ZNF 544; ZNF544
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NX49
-
Expression Region
1-106 aa
-
AA Sequence
MEARSMLVPPQASVCFEDVAMAFTQEEWEQLDLAQRTLYREVTLETWEHIVSLGLFLSKSDVISQLEQEEDLCRAEQEAPRGTSGLSQVTGVVADGSFRFPVWDFT
-
Molecular Weight
38.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF544, a member of the zinc finger protein family, has emerged as a subject of interest in molecular biology due to its potential roles in gene regulation, development, and disease. This protein is characterized by its zinc finger motifs, which enable it to bind DNA and interact with other proteins, suggesting a function in transcriptional regulation. Recent studies have highlighted its implications in various biological processes, including stem cell differentiation and cancer progression. Notably, mutations or aberrant expression of ZNF544 have been associated with certain malignancies, underscoring its relevance in oncogenic pathways. The recombination and expression of ZNF544 as a recombinant protein in laboratory settings provide valuable insights into its functional mechanics and interactions with other cellular components. By elucidating the structural and functional properties of ZNF544, researchers aim to better understand its biological significance and therapeutic potential, establishing a foundation for future studies aimed at targeting its pathways in disease contexts. This growing body of research not only enhances our understanding of ZNF544 itself but also contributes to the broader field of epigenetics and gene regulation.
