Analytical Data
-
Gene name
CAM
- Application
-
Alternative Names
CAM;CAML1;MIC5;Neural cell adhesion molecule L1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96S95
-
Expression Region
1-79aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSEILPYSEDKMGRFGADPEGSDLSFS CRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPS GV
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CAM (Cell Adhesion Molecule) recombinant proteins are pivotal in biological research due to their crucial roles in cell-cell and cell-matrix interactions, which are fundamental in various physiological and pathological processes, including tissue development, immune responses, and cancer progression. The study of CAMs began with the recognition of their functions in stabilizing cell adhesion, guiding cellular signaling pathways, and facilitating tissue organization. As our understanding of these molecules advanced, researchers began to explore their potential as therapeutic targets and biomarkers for diseases. Recombinant technology enables the production of these proteins in a controlled manner, allowing for detailed structural and functional analyses. By engineering CAMs to study their mechanisms of action, researchers have gained insights into how aberrations in adhesion processes contribute to disease states such as metastasis and inflammatory disorders. Moreover, recombinant CAMs serve as valuable tools in regenerative medicine, offering prospects for enhancing tissue engineering strategies by improving cell adhesion and integration in grafts and implants. Overall, the continued investigation of CAM recombinant proteins holds promise for advancing our understanding of cellular dynamics and developing novel therapeutic approaches.











