Analytical Data
-
Gene name
CELSR3
- Application
-
Alternative Names
CELSR3;CDHF11;EGFL1;FMI1;Cadherin EGF LAG seven-pass G-type receptor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYQ7
-
Expression Region
71-180aa
-
AA Sequence
REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGS RERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSP LPSDFLIRHH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CELSR3, a member of the Cadherin EGF LAG seven-pass G-type recepto (CELSR) family, plays a crucial role in various physiological processes, including cell adhesion, neural development, and planar cell polarity. Abnormalities in CELSR3 expression have been associated with multiple diseases, such as developmental disorders and certain types of cancer. The study of CELSR3 recombinant proteins is essential for understanding its mechanism of action and its role in cellular signaling pathways. Utilizing recombinant DNA technology, researchers can produce CELSR3 proteins for structural and functional analyses. This helps elucidate how CELSR3 interacts with other cellular components and contributes to processes like tissue organization and cell communication. Furthermore, the investigation of CELSR3's involvement in disease mechanisms may pave the way for the development of novel therapeutic strategies. By studying CELSR3 at the molecular level, scientists hope to identify potential biomarkers for early diagnosis and targeted treatments, thereby enhancing our understanding of its biological significance in health and disease.











