Analytical Data
-
Gene name
ZNF454
- Application
-
Alternative Names
ZNF454Zinc finger Protein 454
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N9F8
-
Expression Region
1-522 aa
-
AA Sequence
MAVSHLPTMVQESVTFKDVAILFTQEEWGQLSPAQRALYRDVMLENYSNLVSLGLLGPKPDTFSQLEKREVWMPEDTPGGFCLDWMTMPASKKSTVKAEIPEEELDQWTIKERFSSSSHWKCASLLEWQCGGQEISLQRVVLTHPNTPSQEYDESGSTMSSSLHSDQSQGFQPSKNAFECSECGKVFSKSSTLNKHQKIHNEKNANQKIHIKEKRYECRECGKAFHQSTHLIHHQRIHTGEKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPFKCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRIHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKICEKAFIRSTHLTQHQRIHTGEKPYKCNKCGKAFNQTANLIQHQRHHIGEK
-
Molecular Weight
57.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF454, a member of the zinc finger protein family, has gained attention in recent years due to its potential role in various biological processes and diseases. Zinc finger proteins are characterized by the presence of zinc finger motifs, which allow them to bind DNA, RNA, or other proteins, playing critical roles in transcriptional regulation, signal transduction, and cellular differentiation. Initial studies have suggested that ZNF454 may be involved in gene regulation mechanisms that influence cell growth and development. Furthermore, its aberrant expression has been correlated with certain cancers and neurodegenerative disorders, hinting at its significance in pathological conditions. As a result, researchers are increasingly focused on understanding the functional roles and mechanisms of ZNF454 through recombinant protein studies. By producing ZNF454 as a recombinant protein, scientists aim to investigate its structural properties, binding interactions, and regulatory functions in vitro. This research not only enhances our comprehension of ZNF454’s biological significance but also holds promise for developing therapeutic strategies targeting its pathways for disease intervention. Overall, the study of ZNF454 and its recombinant form is crucial for elucidating the complexity of gene regulation and its implications in health and disease.
