Analytical Data
-
Gene name
FAM45A
- Application
-
Alternative Names
FA45A_HUMAN; FAM45A; Family with sequence similarity 45 member A; Protein FAM45A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TCE6
-
Expression Region
1-357aa
-
AA Sequence
MAAAEVADTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFVFGQYRRTWFYITTIEVPDSSILKKVTHFSIVLTAKDFNPEKYAAFTRILCRMYLKHGSPVKMMESYIAVLTKGICQSEENGSFLSKDFDARKAYLAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYVHLNADELEALQMCTGYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI
-
Molecular Weight
66.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM45A, a member of the FAM45 gene family, has garnered attention in recent years due to its potential roles in various biological processes and disease states. Initially identified through its involvement in cellular proliferation and development, FAM45A is believed to influence key pathways associated with cell cycle regulation and apoptosis. Aberrant expression of FAM45A has been implicated in several cancers, suggesting it may function as an oncogene or tumor suppressor, depending on the context. Research indicates that FAM45A interacts with various signaling molecules, including those involved in the PI3K/Akt and MAPK pathways, highlighting its involvement in critical cellular functions. Additionally, studies have suggested a potential role for FAM45A in maintaining genomic stability, as mutations or dysregulation of this protein can lead to chromosomal abnormalities. Given its significance in cancer biology and cellular homeostasis, recombinant FAM45A protein has become a focus for investigations aimed at understanding its structure-function relationships and mechanisms of action, paving the way for potential therapeutic strategies targeting FAM45A-related pathways. Understanding the functional properties of this protein could elucidate its contributions to tumorigenesis and other diseases, thereby influencing future research directions in molecular oncology and therapeutic development.
