Cat: PA1000-8407

Recombinant Human ATR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ATR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ATR;FRP1;Serine/threonine-Protein kinase ATR

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13535

  • Expression Region

    2245-2610aa

  • AA Sequence

    MLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANHASHEPFPGHWAYIA GFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSL INKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLY KEKGVYMTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTF PDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSLTGECVHVD FNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTMRLMR DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLD IEQRLQGVIK TRNRVT

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ATR (ATM and Rad3 related protein) is a key regulator of the cellular response to DNA damage and plays a crucial role in maintaining genomic stability. It belongs to the phosphatidylinositol 3-kinase-related kinase (PIKK) family and is particularly important in the activation of the DNA damage checkpoint response. Research into ATR has gained prominence due to its involvement in various cellular processes, including DNA replication, repair, and cell cycle regulation. Mutations or dysregulation of ATR are linked to several diseases, including cancer, where it can contribute to tumorigenesis by allowing rapidly dividing cells to bypass essential checkpoints. As a result, ATR has emerged as a promising target for cancer therapy, particularly in combination with other treatments such as chemotherapy and radiation, which induce DNA damage. Inhibitors of ATR are being developed and tested in preclinical and clinical trials, aiming to enhance the effectiveness of existing therapies by exploiting the synthetic lethality concept. Moreover, understanding the structural and functional aspects of ATR, including its role in signaling pathways and interactions with other proteins involved in DNA repair, is essential for the rational design of drugs. Collectively, these research efforts underscore the importance of ATR in both basic biology and therapeutic innovation, paving the way for novel strategies in cancer treatment and precision medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US