Cat: PA1000-8402

Recombinant Human DEFb103A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DEFb103A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DEFb103A;BD3;DEFB103;DEFB3;Beta-defensin 103

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P81534

  • Expression Region

    23-67aa

  • AA Sequence

    GIINTLQKYYCRVRGGRCAVLSCLPKEEQI GKCSTRGRKCCRRKK

  • Molecular Weight

    5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of the recombinant protein DEFb103A, a member of the defensin family, is rooted in its potential role as an innate immune effector. Defensins are small, cationic peptides that possess broad-spectrum antimicrobial properties, playing a crucial role in the defense against pathogens. They are produced by various organisms, including plants, insects, and mammals, highlighting their evolutionary significance in immune responses. DEFb103A, specifically identified in certain amphibian species, has garnered attention due to its unique structural attributes and effective antimicrobial activity against bacteria and fungi. Research has suggested that this protein not only serves as a defensive barrier but may also participate in wound healing and modulating inflammation. Understanding the mechanism of action and structure-function relationships of DEFb103A could pave the way for developing new therapeutic agents or enhancing existing antimicrobial strategies. As resistance to conventional antibiotics rises, exploring natural antimicrobial peptides like DEFb103A presents a promising avenue for drug discovery and development, emphasizing the importance of investigating this protein within the broader context of antimicrobial research and immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US