Analytical Data
-
Gene name
DEFB103B
- Application
-
Alternative Names
DEFB103B;BD3;DEFB103;DEFB3;Beta-defensin 103
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P81534
-
Expression Region
23-67aa
-
AA Sequence
GIINTLQKYYCRVRGGRCAVLSCLPKEEQI GKCSTRGRKCCRRKK
-
Molecular Weight
5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DEFB103B, a member of the defensin family, plays a significant role in the innate immune response. It is encoded by the DEFB103B gene located on chromosome 8 and is primarily expressed in epithelial tissues, particularly in the respiratory and gastrointestinal tracts. This antimicrobial peptide exhibits broad-spectrum activity against bacteria, fungi, and viruses, contributing to the first line of defense against pathogens. Studies have revealed its ability to disrupt microbial membranes, which is crucial for its antimicrobial function. Additionally, DEFB103B has been associated with inflammation regulation and wound healing, indicating its potential role in tissue repair. Research has shown that variations in the DEFB103B gene may influence susceptibility to infections and autoimmune diseases, highlighting its importance in human health. Due to its potent antimicrobial properties and involvement in immune regulation, DEFB103B has garnered interest for therapeutic applications, such as developing new antimicrobial agents and enhancing vaccine efficacy. Understanding the structure-function relationship of DEFB103B through recombinant protein studies can provide valuable insights into its mechanism of action and potential clinical applications in combating infectious diseases.











