Analytical Data
-
Gene name
TPTE
- Application
-
Alternative Names
TPTE; Putative tyrosine-Protein phosphatase TPTE; Cancer/testis antigen 44; CT44; Transmembrane phosphatase with tensin homology; Tumor antigen BJ-HCC-5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56180
-
Expression Region
434-533 aa
-
AA Sequence
SVLDNITTDKILIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPTE (T cell protein tyrosine phosphatase) is a member of the protein tyrosine phosphatase (PTP) family, which plays a critical role in regulating various cellular processes, including cell signaling, growth, and differentiation. The study of TPTE has gained significance due to its involvement in immunological functions and potential links to cancer progression and other diseases. Researchers have identified that TPTE is expressed in various tissues, with notable activity in T cells, indicating its role in immune responses. The protein's phosphatase activity regulates tyrosine phosphorylation of specific substrates, which is essential for proper cellular signaling pathways. Recent studies have also suggested that TPTE might modulate the activity of certain oncogenic proteins, highlighting its potential as a therapeutic target in cancer treatment. Additionally, TPTE has been implicated in the modulation of insulin signaling, further expanding its relevance in metabolic diseases. Consequently, the recombinant production of TPTE protein has become a focal point of research, enabling the exploration of its biochemical properties, structural characteristics, and functional mechanisms. By utilizing recombinant techniques, researchers aim to elucidate the role of TPTE in various biological contexts, paving the way for novel therapeutic strategies targeting TPTE-related pathways in diseases. This research is crucial not only for understanding the basic biology of TPTE but also for its implications in developing interventions for immune-related disorders and cancer therapies.
