Analytical Data
-
Gene name
CAPN3
- Application
-
Alternative Names
CAPN3；CANP3；CANPL3；NCL1；Calpain-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20807
-
Expression Region
74-417aa
-
AA Sequence
LYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEIRDAPSDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQDSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWGQVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLT
-
Molecular Weight
46.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CAPN3, also known as calpain-3 or skeletal muscle calpain, is a member of the calpain family of cysteine proteases and plays a crucial role in muscle development and function. Mutations in the CAPN3 gene are linked to limb-girdle muscular dystrophy type 2A (LGMD2A), a genetic disorder characterized by progressive muscle weakness and degeneration. This has made CAPN3 a focal point for research aimed at understanding muscle pathologies and developing potential therapeutic strategies. The study of recombinant CAPN3 protein is critical for elucidating its biological functions, protein interactions, and the effects of specific mutations on its activity. By generating recombinant CAPN3, researchers can conduct detailed biochemical assays to explore its proteolytic activity, substrate specificity, and the regulatory mechanisms governing its function in muscle cells. Additionally, understanding the structure-function relationship of CAPN3 through recombinant protein studies can provide insights into the molecular basis of LGMD2A and aid in the development of targeted treatments for this condition. Furthermore, exploring the potential role of CAPN3 in muscle repair and regeneration may reveal new avenues for enhancing recovery from muscle injuries. Overall, the investigation of CAPN3 as a recombinant protein is essential for advancing our knowledge of muscular dystrophies and improving strategies for intervention in calpain-associated muscle disorders.
