Analytical Data
-
Gene name
FAM109A
- Application
-
Alternative Names
PHETA1; FAM109A; Sesquipedalian-1; Ses1; 27 kDa inositol polyphosphate phosphatase-interacting protein A; IPIP27A; PH domain-containing endocytic trafficking adaptor 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N4B1
-
Expression Region
1-249aa
-
AA Sequence
MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP
-
Molecular Weight
53.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM109A, a member of the FAM109 protein family, has garnered interest in recent years due to its potential role in various cellular processes. Initially identified through a combination of genomic and transcriptomic approaches, FAM109A has been implicated in regulating key biological functions, including cell proliferation, differentiation, and apoptosis. Research indicates that FAM109A may play a significant role in cancer biology, particularly in modulating tumor growth and metastasis, making it a candidate for therapeutic targeting. Additionally, studies have shown that FAM109A interacts with essential signaling pathways, suggesting its involvement in the cellular response to stress and the maintenance of genomic stability. The production of recombinant FAM109A proteins has enabled researchers to delve deeper into its molecular mechanisms and functional properties, facilitating the exploration of its potential as a biomarker or a therapeutic target. The continued investigation of FAM109A is essential for understanding its precise role in health and disease, particularly in the context of malignancies where its dysregulation may contribute to tumorigenesis. This growing body of research underscores the importance of FAM109A in cellular regulation and its possible implications in clinical settings.
