Analytical Data
-
Gene name
FAM105B
- Application
-
Alternative Names
AIPDS; Deubiquitinating enzyme otulin; F105B_HUMAN; Fam105b; Family with sequence similarity 105. member B; FLJ34884; GUM; OTU deubiquitinase with linear linkage specificity; OTULIN; Protein FAM105B; Ubiquitin thioesterase Gumby
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96BN8
-
Expression Region
1-214aa
-
AA Sequence
MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL
-
Molecular Weight
51.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM105B, a member of the FAM (Family with Sequence Similarity) proteins, has garnered attention in recent years due to its potential role in various biological processes and diseases. Initially identified through genomic studies, FAM105B is implicated in cellular functions such as proliferation, differentiation, and apoptosis. Its dysregulation has been linked to multiple pathologies, including cancer and immune disorders. The study of FAM105B recombinant proteins holds promise for elucidating the protein's structure-function relationship and its mechanisms of action at the molecular level. Researchers aim to produce FAM105B as a recombinant protein to facilitate in vitro studies, allowing for a better understanding of its interactions with other cellular components, signaling pathways, and the impact of post-translational modifications. By utilizing techniques such as protein expression and purification in heterologous systems, the functional characterization of FAM105B can advance our knowledge of its biological roles and therapeutic potential. Given the ongoing exploration of protein functions in health and disease, FAM105B represents a novel candidate for further investigation to uncover its significance in cellular biology and its potential as a biomarker or therapeutic target.
