Analytical Data
-
Gene name
FAM102B
- Application
-
Alternative Names
F102B_HUMAN; Fam102b; Protein FAM102B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T8I3
-
Expression Region
1-329aa
-
AA Sequence
MRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASAATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGETLKVHLGIADLSAKSASVPDELGACGHSRTSSYASQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLSRCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGSGAYEQVVIKR
-
Molecular Weight
62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM102B, a member of the FAM (family with sequence similarity) protein family, has garnered attention in recent years due to its potential role in various biological processes and diseases. Research indicates that FAM102B may be involved in cellular signaling pathways, apoptosis, and stress response, suggesting a regulatory function in cellular homeostasis. Notably, its expression patterns are linked to certain cancers and neurodegenerative disorders, prompting investigations into its role as a biomarker or therapeutic target. The production of recombinant FAM102B protein has enabled scientists to delve deeper into its functional characteristics and interactions with other cellular components. This recombinant protein serves as a vital tool for biochemical assays, structural studies, and the exploration of FAM102B's mechanistic roles in health and disease. Understanding the precise functions and interactions of FAM102B not only contributes to the broader field of protein biology but also holds promise for potential applications in targeted therapies. As research continues to evolve, the characterization of FAM102B and its implications in pathophysiology remains a critical area of study in molecular and cellular biology.
