Analytical Data
-
Gene name
PARN
- Application
-
Alternative Names
PARN；DAN；Poly(A)-specific ribonuclease PARN
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95453
-
Expression Region
1-639aa
-
AA Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
-
Molecular Weight
75.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PARN (Poly(A)-specific Ribonuclease) is an essential enzyme involved in the degradation of poly(A) tails from messenger RNAs (mRNAs), playing a crucial role in the regulation of gene expression and mRNA stability. Its activity is vital for proper cellular function, as it helps control the lifespan of mRNAs, thereby influencing protein synthesis and cellular responses to various stimuli. Research on PARN has garnered attention due to its involvement in various biological processes, including cell differentiation, proliferation, and responses to stress. Additionally, dysregulation of PARN has been linked to several diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. The study of recombinant PARN proteins has enabled scientists to delve deeper into its enzymatic mechanisms, structural properties, and interaction with other cellular components. By producing PARN in a recombinant form, researchers can investigate its functional dynamics, develop inhibitors, and explore its role in molecular pathways more effectively. Understanding the intricacies of PARN action not only sheds light on fundamental biological processes but also opens avenues for novel therapeutic strategies aimed at diseases associated with altered mRNA metabolism. Consequently, PARN serves as an important focal point in molecular and cellular biology, with ongoing studies seeking to elucidate its multifaceted roles in health and disease.
