Cat: PAX2000-12074

Recombinant Human TMUB1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMUB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMUB1; C7orf21; DULP; HOPS; SB144; UNQ763/PRO1555; Transmembrane and ubiquitin-like domain-containing Protein 1; Dendritic cell-derived ubiquitin-like Protein; Hepatocyte odd Protein shuttling Protein; Ubiquitin-like Protein SB144

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BVT8

  • Expression Region

    1-246 aa

  • AA Sequence

    MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP

  • Molecular Weight

    52.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMUB1, or Transmembrane and Ubiquitin-like domain containing protein 1, is a protein that plays a pivotal role in various cellular processes, including protein degradation, cell signaling, and stress responses. Recent studies have highlighted its involvement in the regulation of endoplasmic reticulum-associated degradation (ERAD) and its potential implications in diseases such as cancer and neurodegeneration. The exploration of TMUB1 as a recombinant protein serves as a crucial step in understanding its functional mechanisms and interactions within cellular pathways. Researchers aim to produce TMUB1 in a laboratory setting to analyze its structure and biological activity, which may provide insights into its role in pathological conditions. Additionally, recombinant TMUB1 can be utilized in high-throughput screening assays to identify potential small-molecule inhibitors or modifiers that can influence its activity, paving the way for novel therapeutic strategies. The comprehensive study of TMUB1 not only contributes to the fundamental understanding of cellular homeostasis but also holds promise for developing targeted treatments that exploit its unique properties. Thus, the investigation of TMUB1 as a recombinant protein is a significant area of research, bridging basic science and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US