Analytical Data
-
Gene name
SLC
- Application
-
Alternative Names
SLC；NBAT；Amino acid transporter heavy chain SLC3A1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00585
-
Expression Region
24-134aa
-
AA Sequence
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
-
Molecular Weight
43.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC (Solute Carrier) proteins are a diverse family of membrane transporters that play crucial roles in the uptake and export of a wide range of solutes, including ions, sugars, amino acids, and neurotransmitters. These proteins are essential for maintaining cellular homeostasis, regulating metabolism, and facilitating intercellular communication. Given their significant involvement in various physiological processes, including nutrient absorption, ion balance, and drug resistance, SLC proteins are of particular interest in both basic research and clinical applications. Recent studies have highlighted their potential implications in various diseases, such as metabolic disorders, cancer, and neurodegenerative conditions. Despite their importance, the functional characterization of SLC proteins has been hindered by challenges in recombinant expression, purification, and structural analysis. Consequently, research efforts have increasingly focused on developing robust methodologies for generating and studying SLC proteins in vitro. This includes optimizing expression systems, employing advanced purification techniques, and utilizing structural biology approaches to elucidate their mechanisms of action. By gaining a deeper understanding of SLC protein structure and function, researchers aim to uncover novel therapeutic targets and strategies for disease intervention, ultimately advancing the field of drug development and personalized medicine.
