Cat: PA1000-8294

Recombinant Human UQCR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UQCR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UQCR;Cytochrome b-c1 complex subunit 2. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14957

  • Expression Region

    1-56aa

  • AA Sequence

    MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN

  • Molecular Weight

    33.6kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UQCR (Ubiquinone Cytocrome c Reductase) is a crucial enzyme in the mitochondrial respiratory chain, specifically involved in the electron transfer process of oxidative phosphorylation. Its primary role is to facilitate the reduction of ubiquinone to ubiquinol, which is a vital step in energy production within eukaryotic cells. The study of UQCR recombined protein is critical for understanding mitochondrial function, as deficiencies or mutations in this enzyme can lead to a range of mitochondrial disorders, impacting cellular energy metabolism and contributing to various pathologies, including neurodegenerative diseases and heart conditions. Recent advances in recombinant DNA technology have enabled researchers to produce UQCR in a controlled laboratory setting, allowing for detailed structural and functional analysis. By studying this recombinant protein, scientists aim to elucidate its mechanisms of action, identify potential therapeutic targets, and explore its role in mitochondrial bioenergetics. Research on UQCR also encompasses its interactions with other mitochondrial proteins and its involvement in the regulation of reactive oxygen species, further highlighting its significance in maintaining mitochondrial integrity and function. Ultimately, the understanding gained from UQCR recombinant protein studies has implications for developing treatments for mitochondrial diseases and enhancing overall mitochondrial health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US