Analytical Data
-
Gene name
UQCR
- Application
-
Alternative Names
UQCR;Cytochrome b-c1 complex subunit 2. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14957
-
Expression Region
1-56aa
-
AA Sequence
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
-
Molecular Weight
33.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UQCR (Ubiquinone Cytocrome c Reductase) is a crucial enzyme in the mitochondrial respiratory chain, specifically involved in the electron transfer process of oxidative phosphorylation. Its primary role is to facilitate the reduction of ubiquinone to ubiquinol, which is a vital step in energy production within eukaryotic cells. The study of UQCR recombined protein is critical for understanding mitochondrial function, as deficiencies or mutations in this enzyme can lead to a range of mitochondrial disorders, impacting cellular energy metabolism and contributing to various pathologies, including neurodegenerative diseases and heart conditions. Recent advances in recombinant DNA technology have enabled researchers to produce UQCR in a controlled laboratory setting, allowing for detailed structural and functional analysis. By studying this recombinant protein, scientists aim to elucidate its mechanisms of action, identify potential therapeutic targets, and explore its role in mitochondrial bioenergetics. Research on UQCR also encompasses its interactions with other mitochondrial proteins and its involvement in the regulation of reactive oxygen species, further highlighting its significance in maintaining mitochondrial integrity and function. Ultimately, the understanding gained from UQCR recombinant protein studies has implications for developing treatments for mitochondrial diseases and enhancing overall mitochondrial health.











