Analytical Data
-
Gene name
ESCO2
- Application
-
Alternative Names
ESCO2N-acetyltransferase ESCO2; EC 2.3.1.-; Establishment factor-like protein 2; EFO2; EFO2p; hEFO2; Establishment of cohesion 1 homolog 2; ECO1 homolog 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q56NI9
-
Expression Region
1-601aa
-
AA Sequence
MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQPKYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLENEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHKVDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNFMKQTNIQKNTNTRDTSKKTKDQLIIDAGQKHFGATVCKSCGMIYTASNPEDEMQHVQHHHRFLEGIKYVGWKKERVVAEFWDGKIVLVLPHDPSFAIKKVEDVQELVDNELGFQQVVPKCPNKIKTFLFISDEKRVVGCLIAEPIKQAFRVLSEPIGPESPSSTECPRAWQCSDVPEPAVCGISRIWVFRLKRRKRIARRLVDTLRNCFMFGCFLSTDEIAFSDPTPDGKLFATKYCNTPNFLVYNFNS
-
Molecular Weight
93.06 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ESCO2 is a crucial protein involved in the regulation of sister chromatid cohesion during cell division. It is a member of theESCO family of proteins, specifically known for its role in the acetylation of cohesin, a protein complex that holds sister chromatids together until anaphase. Mutations in the ESCO2 gene have been linked to a rare genetic disorder known as Roberts syndrome, characterized by growth retardation, limb malformations, and various other developmental abnormalities. The study of ESCO2 and its associated pathways is essential for understanding the molecular mechanisms underlying chromosomal stability and segregation. Research on ESCO2 reconstitution proteins aims to elucidate the biochemical functions of ESCO2 in cohesin regulation and how its dysfunction can lead to genomic instability and associated diseases. This area of study not only sheds light on fundamental cellular processes but also provides potential therapeutic avenues for conditions arising from chromosomal missegregation. As a result, researchers are focused on characterizing ESCO2's interactions, post-translational modifications, and its role in the context of the cell cycle, which are vital for advancing our understanding of both normal cellular function and the pathogenesis of related disorders.
