Analytical Data
-
Gene name
ZNF184
- Application
-
Alternative Names
Zinc finger Protein 184 (Kruppel like); Zinc finger Protein 184; ZN184_HUMAN; ZNF184
-
Species
Human
-
Source
E. coli
-
Tag
His-DHFR tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99676
-
Expression Region
316-586 aa
-
AA Sequence
QRTHLVQHQRIHTGEKPYTCNECGKAFSQRGHFMEHQKIHTGEKPFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECNECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNECGKAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAFIRSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQHRKIHTGERPY
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF184, a member of the zinc finger protein family, has garnered significant interest due to its potential role in gene regulation and its involvement in various biological processes, including cell differentiation and proliferation. Its characteristic zinc finger motifs enable it to interact with DNA and other proteins, thereby influencing transcriptional activities. Research has suggested that ZNF184 may be implicated in several pathological conditions, including cancer, making it a potential biomarker or therapeutic target. To further understand its biological functions and interactions, recombinant ZNF184 protein is often produced using expression systems such as bacterial or eukaryotic cells. This allows for the characterization of its structure, stability, and functional assays to elucidate its role in cellular mechanisms. Studies on ZNF184 may provide insights into its application in biotechnology and medicine, particularly in the development of targeted therapies for diseases associated with its dysregulation. As the understanding of ZNF184 and its molecular functions grows, it may pave the way for innovative approaches in diagnosis and treatment.
