Analytical Data
-
Gene name
TMEM175
- Application
-
Alternative Names
TMEM175; Endosomal/lysosomal potassium channel TMEM175; Transmembrane Protein 175; hTMEM175
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BSA9
-
Expression Region
1-504 aa
-
AA Sequence
MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMFAKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLARPEHPPPAPTGQDDPQSQLLPAPC
-
Molecular Weight
82 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM175 is a member of the transmembrane protein family, predominantly expressed in neurons, and is believed to play a crucial role in maintaining ion homeostasis and cellular pH. Recent studies have linked TMEM175 to various neurodegenerative diseases, including Parkinson's disease, suggesting that its dysfunction might contribute to the pathogenesis of these conditions. Researchers have identified TMEM175 as a lysosomal ion channel, essential for regulating the transport of ions such as potassium and chloride across cellular membranes. The reconstitution of TMEM175 protein in vitro is essential for understanding its structure-function relationships and its physiological roles. Efforts to express and purify recombinant TMEM175 protein have been initiated to investigate its ion channel activity, gating mechanisms, and interactions with other cellular components. Such studies are crucial, as they may unveil novel therapeutic targets for treating neurodegenerative disorders associated with TMEM175 mutations or dysregulation. Furthermore, utilizing advanced techniques like electrophysiology and structural biology will enhance our understanding of this protein's contribution to neuronal health and highlight the importance of ion channels in cellular homeostasis, thereby opening new avenues for the development of innovative treatment strategies.
