Analytical Data
-
Gene name
PTPRB
- Application
-
Alternative Names
PTPRB；PTPB；Receptor-type tyrosine-Protein phosphatase beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23467
-
Expression Region
1643-1997aa
-
AA Sequence
RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPRB, also known as Protein Tyrosine Phosphatase Receptor Type B, is a key regulator in various cellular processes, including cell adhesion, migration, and signaling pathways. It plays a crucial role in several physiological and pathological conditions, including cancer and immune responses. The study of PTPRB has gained significant attention due to its potential as a therapeutic target, particularly in tumor biology, where its expression levels are often altered. Understanding the structure and function of PTPRB at a molecular level can provide insights into how it modulates signaling pathways that are essential for cellular communication and interaction. Recombinant PTPRB proteins are essential for elucidating its biochemical properties and for developing high-throughput screening assays aimed at identifying small-molecule inhibitors or activators. Furthermore, the availability of purified, functional PTPRB allows for in vitro studies to dissect its role in pathological contexts, paving the way for innovative therapeutic strategies. Therefore, the recombinant expression and purification of PTPRB is a vital step in advancing our knowledge and harnessing its potential for drug development and disease treatment.
