Analytical Data
-
Gene name
PPP1R1B
- Application
-
Alternative Names
PPP1R1B；DARPP32；Protein phosphatase 1 regulatory subunit 1B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UD71
-
Expression Region
1-168aa
-
AA Sequence
MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPP
-
Molecular Weight
23.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP1R1B, also known as Protein Phosphatase 1 Regulatory Inhibitor Subunit 1B, plays a crucial role in regulating protein phosphatase 1 (PP1) activity, an essential component in various cellular processes such as cell division, metabolism, and signal transduction. The dysregulation of PP1 has been implicated in numerous diseases, including cancer and neurodegenerative disorders. The study of PPP1R1B and its recombinant protein is significant as it contributes to our understanding of PP1 regulatory mechanisms and offers insights into the potential therapeutic targets for drug development. By using recombinant DNA technology, researchers can produce purified PPP1R1B proteins, allowing for detailed studies of their biochemical properties, interactions with various substrates and regulatory proteins, and their functional implications in cellular signaling pathways. Understanding the structure-function relationship of PPP1R1B can lead to the identification of specific inhibitors or modulators that may restore normal PP1 function in pathological conditions. Accordingly, ongoing research focuses on elucidating the molecular mechanisms by which PPP1R1B influences PP1 activity, aiming to uncover novel strategies for therapeutic intervention against diseases associated with PP1 dysregulation.
