Analytical Data
-
Gene name
ZFP30
- Application
-
Alternative Names
KIAA0961; ZFP 30; Zfp-30; ZFP30; ZFP30_HUMAN; Zinc finger Protein 30 homolog; Zinc finger Protein 745; ZNF745
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2G7
-
Expression Region
1-519 aa
-
AA Sequence
MARDLVMFRDVAVDFSQEEWECLNSYQRNLYRDVILENYSNLVSLAGCSISKPDVITLLEQGKEPWMVVRDEKRRWTLDLESRYDTKKLFQGKDIYEMNLSQWKVMERIKSCGLEEQESPHEVCFRQVTKTTSEKMPTYRKLTSLPLYQKSHNREKPYECGECGKAFRVRQQLTFHQRIHTGEKPYECKECGKAFRQCAHLSRHQRIHTSDKLYECKKCGKIFTCGSDLRVHQRIHIGEKPYECKECGKAFRVRGQLNLHQRIHTGEKPYECKECGKAFRQYAHLTRHQRLNIAEKCYECKECGQAFLCSTGLRLHHKLHTGEKPYECKECGKAFRVRQQLTLHQRIHTGEKPYDCKECGKTFSRGYHLTLHQRIHTGEKPYECKECQKFFRRYSELISHQGIHIGEKPYECKECGKAFRLFSQLTQHQSIHFGEKPFKCKECEKTFRLLSQLTQHQSIHTGEKPYDCKECGKAFRLHSSLIQHQRIHSGEKPYKCKECKKAFRQHSHLTYHQRIHNVT
-
Molecular Weight
57.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZFP30 is a zinc finger protein that plays a significant role in gene regulation and various biological processes. Its unique structure, characterized by multiple zinc finger motifs, allows it to bind specific DNA sequences, thereby influencing transcriptional activity. Recent research has highlighted the involvement of ZFP30 in developmental processes, stress responses, and cellular differentiation. Understanding the function of ZFP30 and its interaction with other molecular players is crucial for elucidating the regulatory networks within cells. Additionally, ZFP30 has been implicated in certain diseases, making it a potential target for therapeutic interventions. The recombinant expression of ZFP30 provides an opportunity to study its properties and functions in detail, offering insights into its role in health and disease. Researchers are increasingly interested in harnessing ZFP30 for biotechnological applications, including gene therapy and synthetic biology, due to its modular nature and ability to be engineered for specific binding properties. By analyzing ZFP30 through recombinant protein techniques, scientists hope to uncover its molecular mechanisms, paving the way for novel strategies in genetic regulation and disease treatment.
