Analytical Data
-
Gene name
FGF6
- Application
-
Alternative Names
FGF6；HST2；HSTF2；Fibroblast growth factor 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10767
-
Expression Region
41-208aa
-
AA Sequence
MGTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLY CNVGIGFHLQVLPDGRISGTHEENPYSLLEISTVERGVVSLFGVRSALFV AMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTYIALSKYGRV KRGSKVSPIMTVTHFLPRI
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast Growth Factor 6 (FGF6) is a member of the fibroblast growth factor family, which plays a crucial role in various biological processes, including cell proliferation, differentiation, and tissue repair. Research into FGF6 has gained attention due to its significant involvement in muscle development and regeneration, particularly within the context of skeletal muscle and cardiac tissue. Unlike other FGFs, FGF6 is uniquely expressed in myogenic tissues, suggesting a specialized function in muscle repair and regeneration following injury. Studies have indicated that FGF6 can stimulate satellite cell proliferation and enhance muscle repair, positioning it as a potential therapeutic target for muscle atrophy and degenerative diseases. Furthermore, understanding the molecular mechanisms underlying FGF6's action could provide insights into its regulatory pathways, revealing potential applications in regenerative medicine and muscle wound healing. Given the rising incidence of muscle-related disorders and the limitations of current treatment options, FGF6 recombinant protein is being explored for its therapeutic potential to improve muscle recovery and function, making it a focus of ongoing research in the fields of biotechnology and molecular medicine.
