Analytical Data
-
Gene name
ACTHR
- Application
-
Alternative Names
ACTHR；ACTHR；Adrenocorticotropic hormone receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01718
-
Expression Region
1-297aa
-
AA Sequence
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
-
Molecular Weight
33.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACTHR, or Activin A receptor type 2B, is a pivotal component of the Activin signaling pathway, which plays a crucial role in numerous biological processes, including embryonic development, cellular differentiation, and tissue homeostasis. Aberrant Activin signaling has been implicated in various pathologies, such as cancer, fibrosis, and autoimmune diseases, highlighting the therapeutic potential of targeting this pathway. The recombinant protein of ACTHR is used to study its structure-function relationships and to elucidate the molecular mechanisms underlying its interactions with ligands and other signaling components. The production of recombinant ACTHR allows researchers to investigate its binding affinity to Activin ligands, assess the effects of various mutations, and evaluate the downstream signaling cascades it triggers. Understanding the precise roles of ACTHR in cellular contexts can lead to novel therapeutic strategies for diseases associated with its dysregulation. The study of ACTHR as a recombinant protein also provides insights into the development of small-molecule inhibitors or antibodies that could modulate its activity, offering new avenues for intervention in diseases where Activin signaling is aberrant. Overall, research on ACTHR and its recombinant form is essential for advancing our knowledge of the biological roles of Activins and their receptors in health and disease.
