Analytical Data
-
Gene name
ZCCHC6
- Application
-
Alternative Names
TUT7; HS2; KIAA1711; ZCCHC6; Terminal uridylyltransferase 7; TUTase 7; EC 2.7.7.52; Zinc finger CCHC domain-containing Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VYS8
-
Expression Region
1-412 aa
-
AA Sequence
MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDVLIESIAFAHKHIKEKRHKKNIKEKQEEELLTTLPPPTPSQINAVGIAIDKVVQEFGLHNENLEQRLEIKRIMENVFQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQFPAIMSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCREKQRSHFFKLFIY
-
Molecular Weight
74.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZCCHC6, a member of the zinc finger CCCH-type containing protein family, has garnered significant attention in recent years due to its potential roles in various biological processes, particularly in RNA metabolism and cellular stress responses. Research indicates that ZCCHC6 may influence mRNA stability and translation by interacting with specific RNA molecules, thereby impacting gene expression regulation. Additionally, studies have suggested that ZCCHC6 could be involved in the modulation of immune responses and in the regulation of cell proliferation, hinting at its relevance in cancer biology. Given the increasing prevalence of diseases linked to dysregulated gene expression, understanding the functional mechanisms of ZCCHC6 offers valuable insights into potential therapeutic targets. Furthermore, the protein's structural features, including the presence of multiple zinc finger motifs, suggest a sophisticated mechanism of action that warrants detailed investigation. As recombinant protein studies expand, efforts to elucidate the biochemical properties and interaction networks of ZCCHC6 will enhance our comprehension of its roles in health and disease, paving the way for future research avenues aimed at exploring its relevance in therapeutic strategies.











