Cat: PAX2000-12511

Recombinant Human WDR27 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WDR27

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    WDR27WD repeat-containing Protein 27

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A2RRH5

  • Expression Region

    1-266 aa

  • AA Sequence

    MENPQDIFSSNGGCLSDIVIEKYLVESKESVSHVQLACSMQDCAFPLDGTELCIWNTKDPSHQLLILRGHHQPITAMAFGNKVNPLLICSASLDYVIMWNLDECREKVLQGLVPRGTVMGSLLGKVLCLQLSPDDHVVAVCAGNKIFMLDIEQRFSVTYIERPDVNNRHKVPPPTFLHTFSQAQAVRAELQGHLGPVTAVEFCPWRAGTLISASEDRGFKVWDHCTGSLIYSSSVLSAYPLLSLFIDAESRQLVTGVLTASFGSSV

  • Molecular Weight

    55.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WDR27, or WD-repeat domain 27, is a member of the WD-repeat protein family, which is characterized by the presence of multiple WD40 repeats that facilitate protein-protein interactions, playing crucial roles in various cellular processes. Recent research has highlighted WDR27's involvement in critical biological pathways, including cell proliferation, differentiation, and apoptosis. Dysregulation of WDR27 has been implicated in various diseases, particularly cancer, where its expression levels may influence tumor growth and response to therapy. Given its potential as a biomarker and therapeutic target, the study of WDR27 recombinant proteins has gained significant traction. By expressing and purifying WDR27 in a recombinant system, researchers aim to explore its structure-function relationship, elucidate its biological roles, and understand its interactions with other cellular proteins. This research could lead to new insights into the molecular mechanisms underlying cancer and other diseases, as well as the development of novel therapeutic strategies targeting WDR27. Additionally, investigating WDR27’s post-translational modifications and its regulation may further clarify its role in cellular processes and disease states. Thus, the study of WDR27 recombinant proteins not only advances our understanding of fundamental biological processes but also holds promise for therapeutic innovations in managing diseases associated with WDR27 dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US