Cat: PA2000-7176

Recombinant Human DNAJC3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DNAJC3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DnaJ (Hsp40) homolog subfamily C member 3; DnaJ homolog subfamily C member 3; DNAJC3; DNJC3_HUMAN; double-stranded RNA-activated protein kinase inhibitor; Endoplasmic reticulum DnaJ protein 6; ERdj6; HP58; Interferon induced; double stranded RNA activated protein kinase inhibitor; Interferon-induced; P58; p58 ipk; P58IPK; PRKRI

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13217

  • Expression Region

    1-234aa

  • AA Sequence

    MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS

  • Molecular Weight

    51.48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DNAJC3, also known as DnaJ homolog subfamily C member 3, is a member of the heat shock protein (Hsp40) family, which plays a critical role in protein folding and cellular stress responses. Recent studies have highlighted its involvement in various cellular processes, including protein quality control, chaperone activity, and the regulation of protein degradation pathways. DNAJC3 is particularly abundant in the brain and has been implicated in neurodegenerative diseases, such as Alzheimer’s and Parkinson’s, due to its potential role in mitigating protein misfolding and aggregation. Understanding the function and mechanisms of DNAJC3 is paramount for developing therapeutic strategies against these diseases. Moreover, research into DNAJC3 recombinant proteins has gained traction, as scientists seek to purify and characterize these proteins to elucidate their structure-function relationships better. By expressing DNAJC3 in model systems, researchers can investigate its interactions with other proteins and its role in cellular pathways under stress conditions. This research not only sheds light on the fundamental biology of DNAJC3 but also advances our understanding of its potential as a therapeutic target, making it a significant focus within the fields of molecular biology and neurobiology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US