Analytical Data
-
Gene name
DNAJC3
- Application
-
Alternative Names
DnaJ (Hsp40) homolog subfamily C member 3; DnaJ homolog subfamily C member 3; DNAJC3; DNJC3_HUMAN; double-stranded RNA-activated protein kinase inhibitor; Endoplasmic reticulum DnaJ protein 6; ERdj6; HP58; Interferon induced; double stranded RNA activated protein kinase inhibitor; Interferon-induced; P58; p58 ipk; P58IPK; PRKRI
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13217
-
Expression Region
1-234aa
-
AA Sequence
MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
-
Molecular Weight
51.48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNAJC3, also known as DnaJ homolog subfamily C member 3, is a member of the heat shock protein (Hsp40) family, which plays a critical role in protein folding and cellular stress responses. Recent studies have highlighted its involvement in various cellular processes, including protein quality control, chaperone activity, and the regulation of protein degradation pathways. DNAJC3 is particularly abundant in the brain and has been implicated in neurodegenerative diseases, such as Alzheimer’s and Parkinson’s, due to its potential role in mitigating protein misfolding and aggregation. Understanding the function and mechanisms of DNAJC3 is paramount for developing therapeutic strategies against these diseases. Moreover, research into DNAJC3 recombinant proteins has gained traction, as scientists seek to purify and characterize these proteins to elucidate their structure-function relationships better. By expressing DNAJC3 in model systems, researchers can investigate its interactions with other proteins and its role in cellular pathways under stress conditions. This research not only sheds light on the fundamental biology of DNAJC3 but also advances our understanding of its potential as a therapeutic target, making it a significant focus within the fields of molecular biology and neurobiology.
