Analytical Data
-
Gene name
CTAG1B
- Application
-
Alternative Names
CTAG1B；CTAG；CTAG1；ESO1；Cancer/testis antigen 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78358
-
Expression Region
1-180aa
-
AA Sequence
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGA ARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPM EAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSIS SCLQQLSLLMWITQCFLPVFLAQPPSGQRR
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTAG1B (Cancer/testis antigen 1B) is a gene located on chromosome X that encodes a protein primarily expressed in spermatogenic cells and various cancer tissues, making it a candidate for cancer immunotherapy. Its expression in tumors and limited presence in normal tissues highlights its potential as a biomarker for diagnosis and treatment strategies in malignancies, particularly in testicular cancer and melanoma. Research has shown that CTAG1B is involved in the regulation of immune responses, where it may elicit T-cell responses against tumors. The specificity of its expression in cancer cells provides a unique opportunity to develop targeted therapies, including vaccines and antibody-based treatments. Studies have also indicated that CTAG1B may be part of the larger category of cancer/testis antigens, which are of significant interest for their potential to differentiate between tumor and normal tissues, thus enabling a more personalized approach to cancer treatment. Investigating the recombinant form of CTAG1B can further elucidate its structure and function, paving the way for novel therapeutic interventions and enhancing the effectiveness of existing cancer vaccines. Overall, the research on CTAG1B recombinant protein represents a promising frontier in the development of immunotherapeutic strategies aimed at harnessing the immune system to combat cancer.
