Analytical Data
-
Gene name
DNAJB1
- Application
-
Alternative Names
DnaJ (Hsp40) homolog subfmaily B member 1; DNAJ 1; DNAJ B1; DnaJ heat shock protein family (Hsp40) member B1; DnaJ homolog subfamily B member 1; DnaJ protein homolog 1; DNAJ1; DNAJB 1; Dnajb1; DNAJB1 protein; DNJB1_HUMAN; HDJ 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25685
-
Expression Region
1-340aa
-
AA Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
-
Molecular Weight
65.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNAJB1, a member of the HSP40 chaperone family, is known for its crucial role in protein folding and cellular stress responses. Recent research has highlighted the significance of DNAJB1 in various physiological and pathological contexts, particularly in cancer biology and neurodegenerative diseases. The gene encoding DNAJB1 can undergo specific rearrangements that result in fusion proteins, such as DNAJB1-BRAF, which have been implicated in certain types of tumors, including pleomorphic xanthoastrocytoma. Understanding the structure and function of recombinant DNAJB1 proteins provides valuable insights into their role in cellular mechanisms and disease pathways. The study of these recombinant proteins allows researchers to investigate their interactions with other cellular components, elucidate their chaperone activity, and explore potential therapeutic targets for conditions associated with DNAJB1 alterations. By employing techniques such as molecular cloning and protein expression systems, scientists can produce large quantities of pure DNAJB1 protein for functional assays, which may lead to novel strategies for cancer treatment and improved understanding of stress response mechanisms in cells. Overall, the investigation of recombinant DNAJB1 proteins represents a critical area of research with implications for developing interventions in diseases where protein misfolding and signaling dysregulation are key factors.
