Cat: PA2000-7167

Recombinant Human DNAJB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DNAJB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DnaJ (Hsp40) homolog subfmaily B member 1; DNAJ 1; DNAJ B1; DnaJ heat shock protein family (Hsp40) member B1; DnaJ homolog subfamily B member 1; DnaJ protein homolog 1; DNAJ1; DNAJB 1; Dnajb1; DNAJB1 protein; DNJB1_HUMAN; HDJ 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25685

  • Expression Region

    1-340aa

  • AA Sequence

    MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

  • Molecular Weight

    65.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DNAJB1, a member of the HSP40 chaperone family, is known for its crucial role in protein folding and cellular stress responses. Recent research has highlighted the significance of DNAJB1 in various physiological and pathological contexts, particularly in cancer biology and neurodegenerative diseases. The gene encoding DNAJB1 can undergo specific rearrangements that result in fusion proteins, such as DNAJB1-BRAF, which have been implicated in certain types of tumors, including pleomorphic xanthoastrocytoma. Understanding the structure and function of recombinant DNAJB1 proteins provides valuable insights into their role in cellular mechanisms and disease pathways. The study of these recombinant proteins allows researchers to investigate their interactions with other cellular components, elucidate their chaperone activity, and explore potential therapeutic targets for conditions associated with DNAJB1 alterations. By employing techniques such as molecular cloning and protein expression systems, scientists can produce large quantities of pure DNAJB1 protein for functional assays, which may lead to novel strategies for cancer treatment and improved understanding of stress response mechanisms in cells. Overall, the investigation of recombinant DNAJB1 proteins represents a critical area of research with implications for developing interventions in diseases where protein misfolding and signaling dysregulation are key factors.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US