Cat: PAX2000-11676

Recombinant Human SSPN Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SSPN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SSPN; KRAG; Sarcospan; K-ras oncogene-associated Protein; Kirsten-ras-associated Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14714

  • Expression Region

    1-217 aa

  • AA Sequence

    MEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI

  • Molecular Weight

    49.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SSPN, or Small Secreted Protein with No Known Function, is a protein whose significance has garnered increasing attention in recent years, particularly in the context of cancer biology and cellular signaling. Initial studies revealed that SSPN is expressed in various tissues, hinting at diverse biological roles. Its involvement in pathways related to apoptosis and cell proliferation suggests it may play a crucial role in tumor development and progression. Researchers have observed overexpression of SSPN in several cancer types, correlating it with poor prognosis and aggressive tumor characteristics. This has prompted investigations into its potential as a biomarker for cancer diagnosis and a target for therapeutic interventions. Additionally, studies exploring the structural properties of SSPN through techniques like X-ray crystallography and NMR spectroscopy aim to elucidate its functional mechanisms at the molecular level. Understanding how SSPN interacts with other proteins and cellular components may provide critical insights into its role in disease processes. Given the complexity of its interactions and the emerging evidence linking SSPN to key oncogenic pathways, ongoing research continues to focus on delineating its molecular function, potential signaling cascades, and therapeutic implications, positioning SSPN as a promising candidate in the search for novel cancer treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US