Cat: PA1000-7928

Recombinant Human Smad9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Smad9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Smad9;MADH6;MADH9;SMAD8;Mothers against decapentaplegic homolog 9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15198

  • Expression Region

    1-467aa

  • AA Sequence

    MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKG AMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPD LQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEY NPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQS PCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQSGQPVDATAD RHVVLSIPNGDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDG FTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECV SDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHH GFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLD KVLTQMGSPHNPISSVS

  • Molecular Weight

    86 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Smad9 is a member of the Smad protein family, which plays a crucial role in the transforming growth factor-beta (TGF-β) signaling pathway. This pathway is essential for various biological processes, including cell growth, differentiation, and apoptosis. Smad9, in particular, is involved in mediating the effects of certain TGF-β superfamily members, such as inhibin, which are important in reproductive biology and organ development. The dysregulation of Smad9 expression or function has been implicated in various diseases, including fibrosis, cancer, and developmental disorders. Recent studies have focused on the characterization of recombinant Smad9 proteins to better understand its structural and functional properties. The production of these recombinant proteins allows researchers to investigate the molecular mechanisms through which Smad9 interacts with other signaling molecules, as well as its role in cellular responses to extracellular signals. By analyzing the activity of recombinant Smad9, scientists aim to elucidate its contributions to the TGF-β signaling pathway and identify potential therapeutic targets for diseases associated with its dysfunction. This research is vital not only for understanding fundamental cellular processes but also for developing strategies to manipulate this pathway for therapeutic benefit in various pathological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US