Cat: PA1000-7927

Recombinant Human Smad7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Smad7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Smad7;MADH7;MADH8;Mothers against decapentaplegic homolog 7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15105

  • Expression Region

    160-260aa

  • AA Sequence

    CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPP PYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRS H

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Smad7 is a critical protein involved in the transforming growth factor-beta (TGF-β) signaling pathway, which plays a vital role in regulating various biological processes, including cell proliferation, differentiation, and apoptosis. As an inhibitory Smad, Smad7 functions by antagonizing the actions of receptor-activated Smads, effectively preventing the transcriptional activation of target genes induced by TGF-β signals. Research has shown that aberrant regulation of Smad7 is associated with a range of diseases, including cancer, fibrosis, and autoimmune disorders. Due to its role in moderating TGF-β signaling, Smad7 has garnered interest as a potential therapeutic target. Recombinant Smad7 protein studies aim to elucidate its mechanistic roles and effects on cellular processes. Through the production of recombinant Smad7, researchers can investigate its interactions with other signaling molecules, its impact on gene expression, and its overall contribution to pathophysiological conditions. Furthermore, the development of Smad7-based therapies may offer novel strategies for treating TGF-β-related diseases by restoring its regulatory functions. As the understanding of Smad7 continues to evolve, it stands as a promising focal point for innovative medical interventions and a deeper comprehension of TGF-β signaling mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US