Analytical Data
-
Gene name
COL17A1
- Application
-
Alternative Names
COL17A1；Integrin beta-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UMD9
-
Expression Region
1253-1497aa
-
AA Sequence
YLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP
-
Molecular Weight
28.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL17A1, also known as collagen type XVII alpha 1, is a critical component of the extracellular matrix and a key player in cell adhesion and skin integrity. This protein is primarily expressed in the basal layer of the epidermis and is associated with the hemidesmosomes that anchor the epidermis to the underlying basement membrane. Mutations in the COL17A1 gene can lead to various skin disorders, including epidermolysis bullosa, a condition characterized by extreme fragility of the skin resulting in blister formation upon minimal friction. Due to its importance in skin biology and pathology, COL17A1 has garnered significant research interest, particularly in understanding its role in skin health, disease mechanisms, and potential therapeutic targets. Recombinant COL17A1 proteins have been developed to investigate their structure-function relationships, study protein interactions, and explore their potential as biomarkers or therapeutic agents in dermatological diseases. Furthermore, understanding the molecular dynamics of COL17A1 may contribute to advancements in regenerative medicine and tissue engineering, offering insights into wound healing and skin repair processes. Overall, the study of recombinant COL17A1 proteins is pivotal for elucidating the underlying mechanisms of skin integrity and disease, with significant implications for developing innovative treatments for skin-related conditions.
