Cat: PA2000-7137

Recombinant Human DLEU2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DLEU2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43262

  • Expression Region

    1-84aa

  • AA Sequence

    MRLRFNNDRMKTTIKETTILSSAILTFLTYLMKMSFERCTARNKMFVNSPFYPRVDNYCTSSWKKFYLKCYFSLNTIKKEKKMT

  • Molecular Weight

    36.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DLEU2, a long non-coding RNA (lncRNA), has garnered significant attention in recent years due to its potential involvement in various biological processes and diseases, particularly in cancer progression. Located at chromosome 13q14, DLEU2 plays a critical role in regulating gene expression and has been implicated in cellular pathways associated with tumorigenesis and metastasis. Studies suggest that DLEU2 may act as a tumor suppressor, influencing cell proliferation, apoptosis, and migration in various cancers, including chronic lymphocytic leukemia (CLL). The reprogramming of DLEU2 expression in malignancies highlights its potential as a biomarker for diagnosis and prognosis, as well as a promising target for therapeutic interventions. Recent advances in recombinant protein technology have facilitated the production and characterization of DLEU2 protein, providing insights into its molecular mechanisms. Understanding the structure-function relationships of DLEU2 and its interactions with other cellular components can pave the way for novel cancer treatment strategies and improve our comprehension of lncRNA biology. This growing body of research underscores the importance of DLEU2 in cancer research and its potential implications in therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US