Analytical Data
-
Gene name
SPIRE1
- Application
-
Alternative Names
Protein spire homolog 1. Spir-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q08AE8
-
Expression Region
1-131 aa
-
AA Sequence
MRLPSKPYSTLPIFSLGPSALQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI
-
Molecular Weight
41.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPIRE1 (Spectrin Repeat Interacting Protein 1) is a crucial cytoskeletal protein involved in the regulation of actin dynamics, cell morphology, and intracellular transport. It plays a significant role in various cellular processes, including endocytosis, cell migration, and signal transduction. Research has shown that SPIRE1 interacts with actin filaments and other binding partners, facilitating the assembly of actin-based structures. Moreover, it is implicated in several physiological and pathological conditions, such as neuronal development, cardiac function, and cancer progression. The expression and function of SPIRE1 can be affected by various signaling pathways, highlighting its importance in cellular responses to environmental cues. In recent years, the study of SPIRE1 has gained momentum due to its potential as a therapeutic target in diseases characterized by cellular dysfunction. The production of recombinant SPIRE1 protein allows researchers to study its structure, function, and the mechanisms by which it interacts with other cellular components. This research not only enhances our understanding of SPIRE1's role in normal cellular physiology but may also provide insights into its contribution to disease states, paving the way for potential intervention strategies.
