Analytical Data
-
Gene name
SMPX
- Application
-
Alternative Names
SMPX；SRMX；Small muscular Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHP9
-
Expression Region
1-88aa
-
AA Sequence
MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ
-
Molecular Weight
36.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMPX (smooth muscle protein, x-linked) is a protein primarily expressed in smooth muscle tissues and has garnered interest due to its potential role in muscle contraction and cellular signaling. Research indicates that SMPX may be involved in regulating the cytoskeletal organization and influencing the contractile properties of smooth muscle cells. Its specific location on the X chromosome suggests a unique genetic regulation, which has implications for understanding X-linked disorders. The study of SMPX recombinant proteins has emerged as a vital tool for elucidating the protein's function and its interactions within the cellular environment. Advances in recombinant DNA technology have facilitated the production of SMPX in various expression systems, allowing researchers to investigate its biochemical properties and potential interactions with other muscle-related proteins. This research is essential for deciphering the molecular mechanisms underlying smooth muscle function and the pathophysiology of related diseases, such as hypertension and asthma, where smooth muscle dysfunction plays a critical role. Furthermore, understanding SMPX's interactions and modifications could lead to novel therapeutic strategies aimed at modulating smooth muscle activity, with ramifications in cardiovascular and respiratory medicine. Overall, the exploration of SMPX recombinant proteins stands at the intersection of cell biology and therapeutic development, promising insights that could enhance our understanding of smooth muscle dynamics and inform clinical approaches to smooth muscle-related disorders.
