Analytical Data
-
Gene name
GRIN1
- Application
-
Alternative Names
GRIN1；KIAA1893；G Protein-regulated inducer of neurite outgrowth 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q05586
-
Expression Region
834-938aa
-
AA Sequence
EIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
-
Molecular Weight
18.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRIN1, a gene that encodes the GluN1 subunit of the NMDA receptor, plays a crucial role in neurotransmission and synaptic plasticity in the brain. Mutations in GRIN1 have been associated with various neurological disorders, including epilepsy, intellectual disability, and developmental delay, highlighting its importance in neural function. The NMDA receptor, a key player in excitatory neurotransmission, is involved in critical processes such as learning and memory. Understanding the structure and function of GRIN1 recombinantly expressed proteins can provide insights into the receptor's mechanisms and its pathology in related disorders. Researchers utilize recombinant GRIN1 proteins to study ligand binding, receptor activation, and signaling pathways, opening pathways for therapeutic interventions. Additionally, these recombinant proteins serve as valuable tools for drug screening and the development of small molecules targeting dysfunctional NMDA receptors. Overall, the investigation of GRIN1 recombinant protein is pivotal for advancing our comprehension of excitatory neurotransmission and developing strategies to address GRIN1-related diseases.
