Analytical Data
-
Gene name
GRIN2B
- Application
-
Alternative Names
GRIN2B；Proline-rich Protein 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13224
-
Expression Region
127-236aa
-
AA Sequence
HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYF PGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSP IILLYCTKEE
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The GRIN2B gene encodes the Glutamate Receptor, Ionotropic, NMDA2B, which plays a critical role in neurotransmission and synaptic plasticity in the central nervous system. Mutations and alterations in the GRIN2B gene have been associated with various neurodevelopmental disorders, including intellectual disabilities, autism spectrum disorder, and schizophrenia. Due to its significant implications in neurobiology and potential therapeutic targets for these conditions, researchers have focused on the study of GRIN2B recombinant protein. Recombinant GRIN2B can be expressed and purified for functional studies, enabling scientists to explore its role in synaptic mechanisms and receptor signaling pathways. Investigating the molecular characteristics and functions of the GRIN2B protein could provide insights into the etiology of related psychiatric disorders and facilitate the development of targeted interventions. Understanding how GRIN2B interacts with other proteins and its response to pharmacological agents is crucial for unraveling the complexities of synaptic function and developing potential therapies for GRIN2B-related pathologies. Overall, the research surrounding GRIN2B recombinant protein represents a vital frontier in neuroscience, with the potential to uncover novel molecular targets for therapeutic discovery.
