Analytical Data
-
Gene name
NAT2
- Application
-
Alternative Names
NAT2；NARG1L；NAT2；N-alpha-acetyltransferase 16. NatA auxiliary subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11245
-
Expression Region
1-290aa
-
AA Sequence
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI
-
Molecular Weight
49.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAT2 (N-acetyltransferase 2) is an enzyme involved in the metabolism of various drugs and xenobiotics, playing a crucial role in the biotransformation processes that affect individual drug responses and toxicity. Genetic variations in the NAT2 gene result in distinct phenotypes categorized into fast and slow acetylators, which significantly influence the metabolism of certain medications, including anti-tuberculosis and anti-cancer drugs. Research into NAT2 has garnered attention due to its implications in pharmacogenomics, as understanding these genetic differences can lead to more personalized and effective therapeutic strategies. The study of NAT2 recombinant proteins has facilitated better insights into the enzyme's structure-function relationships, enzymatic activity, and substrate specificity. This research is essential for elucidating the enzyme's role in drug metabolism and the potential associations with adverse drug reactions, cancer susceptibility, and overall health outcomes. By exploring NAT2's biochemical mechanisms, researchers aim to improve drug development processes and optimize clinical treatments tailored to individual patient genotypes.
