Analytical Data
-
Gene name
DIRAS2
- Application
-
Alternative Names
DIRAS2GTP-binding protein Di-Ras2; Distinct subgroup of the Ras family member 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96HU8
-
Expression Region
1-199aa
-
AA Sequence
MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM
-
Molecular Weight
48.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DIRAS2, a member of the Ras superfamily of small GTPases, has garnered attention in recent years due to its potential role in various biological processes and diseases, particularly in cancer progression and stem cell regulation. Research indicates that DIRAS2 is involved in cellular signaling pathways, potentially influencing cell proliferation, differentiation, and apoptosis. Its expression patterns are notably altered in several human tumors, suggesting a possible tumor-suppressive function or a role in cancer metastasis. Furthermore, studies have shown that DIRAS2 can interact with several key cellular proteins, implicating it in the modulation of critical cellular functions. Given its unique structure and functional properties, DIRAS2 is an attractive target for understanding the molecular mechanisms underlying malignancies and for developing novel therapeutic strategies. The generation of recombinant DIRAS2 proteins is essential for elucidating its biochemical activities and interactions, paving the way for experimental investigations. This approach not only enhances our understanding of DIRAS2's role in health and disease but also holds promise for its application in precision medicine and targeted therapies.
