Cat: PA1000-7883

Recombinant Human PIM3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PIM3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PIM3;Serine/threonine-Protein kinase pim-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86V86

  • Expression Region

    1-326aa

  • AA Sequence

    MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGG FGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAA GGARGVIRLLDWFERPDGFL LVLERPEPAQDLFDFITERGALDEPLAR RFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKD TVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQD EEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADG GVPESCDLRLCTLDPDDVASTTSSSESL

  • Molecular Weight

    65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PIM3 (Proviral Integration site for Moloney murine leukemia virus 3) is a serine/threonine kinase that belongs to the PIM family of proteins, which are known to play crucial roles in cell survival, proliferation, and differentiation. Their dysregulation has been implicated in various hematological malignancies and solid tumors, making them attractive targets for cancer therapy. The study of PIM3 has gained momentum due to its involvement in oncogenic pathways, where it promotes cell growth by inhibiting apoptosis and enhancing glycolysis. Additionally, PIM3 interacts with several key signaling molecules, thereby influencing tumor microenvironment dynamics. Recombinant PIM3 protein production is essential for elucidating its biochemical properties and therapeutic potential. Current research efforts focus on delineating the molecular mechanisms by which PIM3 contributes to tumorigenesis, as well as developing inhibitors that can selectively target PIM3 activity. Understanding the structure-function relationship of PIM3 through recombinant protein studies may pave the way for novel cancer treatment strategies, ultimately improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US