Analytical Data
-
Gene name
EPFL9
- Application
-
Alternative Names
EPFL9；STOMAGEN；EPIDERMAL PATTERNING FACTOR-like Protein 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9SV72
-
Expression Region
32-102aa
-
AA Sequence
SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
-
Molecular Weight
10.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EPFL9, part of the LRR (leucine-rich repeat) family of proteins, plays a crucial role in plant developmental processes. Research into EPFL9 has gained traction due to its involvement in regulating various physiological responses, including stomatal development, which is vital for plant gas exchange and overall health. Stomatal movements are influenced by environmental factors, and EPFL9 acts as a signaling molecule in this process, mediating communication between different cell types in response to external stimuli. The study of EPFL9 is particularly significant as it helps elucidate the mechanisms of plant adaptation to changing environments, which is increasingly important in the context of global climate change. Understanding the molecular pathways regulated by EPFL9 may offer insights into enhancing crop resilience and improving agricultural productivity. Furthermore, characterizing its interactions with other proteins and signaling pathways could uncover novel strategies for manipulating plant growth and stress responses. Thus, the investigation of EPFL9 not only contributes to our basic understanding of plant biology but also holds potential applications in sustainable agriculture and food security.
