Cat: PA1000-7864

Recombinant Human ARHGEF7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ARHGEF7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ARHGEF7;COOL1;KIAA0142;P85SPR;Rho guanine nucleotide exchange factor 7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14155

  • Expression Region

    179-428aa

  • AA Sequence

    MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYH

  • Molecular Weight

    55.3kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ARHGEF7, also known as an activating protein for Rho GTPases, is a member of the Rho guanine nucleotide exchange factor (GEF) family, playing a crucial role in the regulation of cellular signaling pathways that impact various physiological processes, including cell migration, proliferation, and morphology. Research has shown that ARHGEF7 is implicated in numerous diseases, particularly in cancer progression and metastasis, where its overexpression is often linked to invasive tumor characteristics. The interactions of ARHGEF7 with Rho GTPases such as RhoA, Rac1, and Cdc42 are pivotal in modulating the actin cytoskeleton and cell adhesion, making it a significant target for therapeutic intervention. In recent years, advances in recombinant protein technology have facilitated the production of ARHGEF7 for in vitro studies, allowing researchers to dissect its functional domains and regulatory mechanisms more effectively. The recombinant ARHGEF7 protein is utilized in biochemical assays to investigate its role in signal transduction and to identify potential small-molecule inhibitors or modulators that could influence its activity in pathological contexts. Overall, the study of ARHGEF7 as a recombinant protein not only enhances our understanding of Rho signaling but also holds promise for developing novel therapeutic strategies in cancer and other diseases associated with aberrant Rho GTPase activity.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US