Analytical Data
-
Gene name
ARHGEF7
- Application
-
Alternative Names
ARHGEF7；COOL1；KIAA0142；P85SPR；Rho guanine nucleotide exchange factor 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14155
-
Expression Region
179-428aa
-
AA Sequence
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYH
-
Molecular Weight
55.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARHGEF7, also known as an activating protein for Rho GTPases, is a member of the Rho guanine nucleotide exchange factor (GEF) family, playing a crucial role in the regulation of cellular signaling pathways that impact various physiological processes, including cell migration, proliferation, and morphology. Research has shown that ARHGEF7 is implicated in numerous diseases, particularly in cancer progression and metastasis, where its overexpression is often linked to invasive tumor characteristics. The interactions of ARHGEF7 with Rho GTPases such as RhoA, Rac1, and Cdc42 are pivotal in modulating the actin cytoskeleton and cell adhesion, making it a significant target for therapeutic intervention. In recent years, advances in recombinant protein technology have facilitated the production of ARHGEF7 for in vitro studies, allowing researchers to dissect its functional domains and regulatory mechanisms more effectively. The recombinant ARHGEF7 protein is utilized in biochemical assays to investigate its role in signal transduction and to identify potential small-molecule inhibitors or modulators that could influence its activity in pathological contexts. Overall, the study of ARHGEF7 as a recombinant protein not only enhances our understanding of Rho signaling but also holds promise for developing novel therapeutic strategies in cancer and other diseases associated with aberrant Rho GTPase activity.
