Cat: PA2000-3435

Recombinant Mouse Il1rl2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Il1rl2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Il1rl2;IL1RRP2;Interleukin-1 receptor-like 2

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9ERS7

  • Expression Region

    22-338aa

  • AA Sequence

    DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

  • Molecular Weight

    49.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Il1rl2, also known as IL-33 receptor or ST2, is a member of the interleukin-1 receptor family that plays a critical role in the immune response and inflammation. It is primarily expressed in various immune cells, including mast cells, T helper 2 cells, and macrophages. The interaction between IL-33 and its receptor IL1RL2 has been associated with several physiological processes, such as tissue repair, homeostasis, and the pathogenesis of allergic diseases and asthma. Recent studies have highlighted the significance of IL1RL2 in promoting Th2 polarization and enhancing cytokine production, which contributes to inflammation and immune regulation. Given its pivotal role in mediating immune responses, the recombinant protein form of IL1RL2 has garnered attention for potential therapeutic applications. Researchers are exploring its use as a biomarker for disease diagnosis and prognosis, particularly in asthma and other allergic disorders. Additionally, understanding the structure and function of IL1RL2 through recombinant protein studies can lead to the development of targeted therapies that modulate its pathway, opening new avenues for treating chronic inflammatory conditions. Overall, the study of IL1RL2 recombinant protein is essential for unraveling its complex roles in immune regulation and for developing innovative strategies to manage diseases linked to dysregulated immune responses.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US