Analytical Data
-
Gene name
Il1rl2
- Application
-
Alternative Names
Il1rl2；IL1RRP2；Interleukin-1 receptor-like 2
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ERS7
-
Expression Region
22-338aa
-
AA Sequence
DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR
-
Molecular Weight
49.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Il1rl2, also known as IL-33 receptor or ST2, is a member of the interleukin-1 receptor family that plays a critical role in the immune response and inflammation. It is primarily expressed in various immune cells, including mast cells, T helper 2 cells, and macrophages. The interaction between IL-33 and its receptor IL1RL2 has been associated with several physiological processes, such as tissue repair, homeostasis, and the pathogenesis of allergic diseases and asthma. Recent studies have highlighted the significance of IL1RL2 in promoting Th2 polarization and enhancing cytokine production, which contributes to inflammation and immune regulation. Given its pivotal role in mediating immune responses, the recombinant protein form of IL1RL2 has garnered attention for potential therapeutic applications. Researchers are exploring its use as a biomarker for disease diagnosis and prognosis, particularly in asthma and other allergic disorders. Additionally, understanding the structure and function of IL1RL2 through recombinant protein studies can lead to the development of targeted therapies that modulate its pathway, opening new avenues for treating chronic inflammatory conditions. Overall, the study of IL1RL2 recombinant protein is essential for unraveling its complex roles in immune regulation and for developing innovative strategies to manage diseases linked to dysregulated immune responses.
