Cat: PA1000-7847

Recombinant Human GPR35 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GPR35

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GPR35;G-Protein coupled receptor 35

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HC97

  • Expression Region

    1-309aa

  • AA Sequence

    MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQ QWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNR YMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVA RWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQ RPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACAL LETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS QDSLCVTLA

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GPR35 is a G protein-coupled receptor that has garnered interest in recent years due to its involvement in various physiological and pathological processes, including immune response, inflammation, and metabolic regulation. Identified as a receptor for kynurenic acid and certain other ligands, GPR35 is believed to play a role in gastrointestinal disorders, cardiovascular diseases, and even cancer. The complexity of its signaling pathways, which may involve β-arrestin and Gq/11 proteins, highlights the need for a deeper understanding of its mechanisms. However, challenges in obtaining functional studies of GPR35 have arisen, primarily due to difficulties in expressing and purifying the receptor in recombinant systems. As a result, a focused effort on the production of recombinant GPR35 protein has emerged, which aims to facilitate detailed pharmacological analyses and structural studies. Such research is crucial for elucidating the receptor's biological functions and potential as a therapeutic target. Advances in protein expression techniques, coupled with the development of specific ligands and antibodies, are expected to accelerate discoveries related to GPR35, potentially leading to novel interventions for diseases linked to this receptor.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US