Analytical Data
-
Gene name
XPG
- Application
-
Alternative Names
XPG；ERCM2；XPG；XPGC；DNA excision repair Protein ERCC-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28715
-
Expression Region
947-1186aa
-
AA Sequence
SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
-
Molecular Weight
30.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
XPG, or xeroderma pigmentosum group G, is a key enzyme involved in the nucleotide excision repair (NER) pathway, which is essential for repairing DNA damage caused by ultraviolet (UV) light and other environmental factors. Mutations in the XPG gene can lead to xeroderma pigmentosum, a rare genetic disorder characterized by extreme sensitivity to UV radiation, resulting in a high risk of skin cancer and other severe skin abnormalities. Research on recombinant XPG proteins is critical for understanding the molecular mechanisms of DNA repair and the role of XPG in cellular responses to DNA damage. By producing and studying recombinant XPG, scientists aim to elucidate its structural and functional properties, mechanisms of action, and interactions with other proteins involved in the NER pathway. This research not only enhances our comprehension of the molecular basis of xeroderma pigmentosum but also has broader implications for cancer biology, as defective DNA repair is a hallmark of many cancers. The insights gained from studying recombinant XPG may lead to novel therapeutic strategies for individuals with DNA repair deficiencies and could inform approaches for enhancing the effectiveness of cancer treatments that exploit DNA damage.
