Analytical Data
-
Gene name
H2AFJ
- Application
-
Alternative Names
H2AFJ；H2AFJ；Histone H2A.J
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BTM1
-
Expression Region
2-129aa
-
AA Sequence
SGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
-
Molecular Weight
40.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2AFJ, a variant histone protein, is part of the histone H2A family and plays a critical role in the regulation of chromatin structure and function. This protein is involved in key biological processes, such as gene expression, DNA repair, and cell cycle regulation. Research on H2AFJ has gained momentum due to its potential implications in various diseases, including cancer. Misregulation or mutations in histone proteins can lead to aberrant gene expression patterns that contribute to tumorigenesis. Recent studies have shown that H2AFJ can influence the chromatin landscape, impacting the accessibility of transcriptional machinery to target genes. Furthermore, H2AFJ’s interactions with other chromatin-associated proteins highlight its importance in the epigenetic regulation of gene activity. The pursuit of recombinant H2AFJ proteins for biochemical and structural studies has become crucial for understanding its functional mechanisms. Such research enhances our comprehension of histone variants in cellular processes and may open new avenues for therapeutic strategies targeting epigenetic modifications in diseases. Thus, investigating H2AFJ not only enriches the fundamental knowledge of chromatin biology but also holds promise for translational research in the context of human health.
