Analytical Data
-
Gene name
H2AFV
- Application
-
Alternative Names
H2AFV；H2AFV；H2AV；Histone H2A.V
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q71UI9
-
Expression Region
1-128aa
-
AA Sequence
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
-
Molecular Weight
29.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2AFV, a variant histone protein, plays a critical role in the regulation of gene expression and chromatin structure. As part of the histone H2A family, H2AFV is particularly interesting due to its involvement in diverse cellular processes such as DNA repair, replication, and cellular response to stress. The study of H2AFV has gained prominence, as alterations in histone variants are often associated with various diseases, including cancer. Researchers are increasingly focused on understanding how H2AFV modifies chromatin dynamics and contributes to epigenetic regulation. Given its unique characteristics, H2AFV serves as a valuable model for elucidating the fundamental mechanisms of chromatin remodeling and gene regulation. The recombinant production of H2AFV allows for the detailed investigation of its biochemical properties and interactions with other chromatin-associated proteins, paving the way for potential therapeutic applications in modulating gene expression in disease contexts. Moreover, the insights gained from H2AFV research could inform the development of novel strategies for targeting epigenetic modifications in therapeutic settings.
